TSG101 Rabbit Polyclonal Antibody

• Catalog Number: orb576274
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSG101
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: TSG101
• UniProt ID: Q61187
• Protein Sequence: Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
• NCBI: NP_068684
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CC2, AI255943
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: mouse fibroblast lusate (10 ug), Primary Dilution: 1:1000 (1% BSA), Secondary Dilution: 1:2000 (5% milk).

Rabbit Anti-Tsg101 Antibody, Paraffin Embedded Tissue: Mouse Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-TSG101 Antibody, Positive Control: Lane 1: 30 ug mouse brain lysate, Lane 2: 30 ug mouse brain lysate, Lane 3: 30 ug mouse brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:50000.

WB Suggested Anti-TSG101 Antibody Titration: 1.25 ug/ml, Positive Control: NIH/3T3 cell lysate.