You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329823 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPC4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPC4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 112kDa |
Target | TRPC4 |
UniProt ID | Q9UBN4 |
Protein Sequence | Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
NCBI | NP_057263 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HTRP4 antibody, anti MGC119570 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.
Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.
Positive control (+): Mouse pancreas (M-PA), Negative control (-): Human intestine (IN), Antibody concentration: 1 ug/mL.
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/mL using anti-TRPC4 antibody (orb329823).
WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |