You have no items in your shopping cart.
TRPC4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPC4 |
| Target | TRPC4 |
| Protein Sequence | Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
| Molecular Weight | 112kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TRPC4AP Antibody [orb632178]
ELISA, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μgTRPC4 Antibody [orb632177]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Mouse pancreas (M-PA), Negative control (-): Human intestine (IN), Antibody concentration: 1 ug/mL.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/mL using anti-TRPC4 antibody (orb329823).

WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
Documents Download
Request a Document
Protocol Information
TRPC4 Rabbit Polyclonal Antibody (orb329823)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






