You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329823 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPC4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPC4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 112kDa |
Target | TRPC4 |
UniProt ID | Q9UBN4 |
Protein Sequence | Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
NCBI | NP_057263 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HTRP4 antibody, anti MGC119570 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 293T cell lysate tissue using TRPC4 antibody
Western blot analysis of human MCF7 tissue using TRPC4 antibody
Western blot analysis of human HepG2 tissue using TRPC4 antibody
ELISA, IHC, WB | |
Bovine, Canine, Mouse, Porcine | |
Human, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating