TPT1 monoclonal antibody (M03), clone 2C4

• Catalog Number: orb2292025
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TPT1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C4
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
• NCBI: AAH22436
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TPT1 is approximately 0.3 ng/ml as a capture antibody.

TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in MCF-7.

TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in NIH/3T3.

TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in PC-12.

TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in Raw 264.7.

Western Blot detection against Immunogen (37.18 KDa).