You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb584181 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TP53INP2 |
| Target | TP53INP2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2 |
| Protein Sequence | Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY |
| UniProt ID | Q8IXH6 |
| MW | 24 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DOR, PIGU, PINH, PIG-U, C20orf110, dJ1181N3.1 |
| Research Area | Autophagic, Cancer, Epigenetics, Neuroscience, Sig Read more... |
| Note | For research use only |
| NCBI | NP_067025 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TP53INP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review