You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584181 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TP53INP2 |
Target | TP53INP2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2 |
Protein Sequence | Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY |
UniProt ID | Q8IXH6 |
MW | 24 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DOR, PIGU, PINH, PIG-U, C20orf110, dJ1181N3.1 |
Note | For research use only |
NCBI | NP_067025 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-TP53INP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |