SRI Antibody

• Catalog Number: orb527008
• Category: Antibodies
• Description: SRI Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 22 kDa
• UniProt ID: P30626
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SiHa cells using anti-SRI antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U20S cells using anti-SRI antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of SR1 using anti-SR1 antibody.Lane 1:human placenta Tissue;2:human U20S Cell;3:human A431 Cell;4:human PC-3 Cell;5:human HL-60 Cell;6:human K562 Cell;7:human Caco-2 Cell;8:rat lung Tissue;9:mouse lung Tissue.

IF analysis of SRI using anti-SRI antibody.SRI was detected in immunocytochemical section of U20S cell.

IHC analysis of SRI using anti-SRI antibody.SRI was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of SRI using anti-SRI antibody.SRI was detected in paraffin-embedded section of human mammary cancer tissues.

IHC analysis of SRI using anti-SRI antibody.SRI was detected in paraffin-embedded section of human lung cancer tissues.