You have no items in your shopping cart.
Cart summary
SLC5A5 Protein, Human, Recombinant (B2M & His)
Catalog Number: orb1977797
| Catalog Number | orb1977797 |
|---|---|
| Category | Proteins |
| Description | May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. SLC5A5 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 27.1 kDa and the accession number is O95436. |
| Tag | N-6xHis-B2M |
| Purity | 98.00% |
| MW | 27.1 kDa (predicted) |
| UniProt ID | O95436 |
| Protein Sequence | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. SLC5A5 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 27.1 kDa and the accession number is O95436. |
| Expression Region | 574-689 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
