SLC12A1 Antibody

• Catalog Number: orb251575
• Category: Antibodies
• Description: SLC12A1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5μg/ml, Monkey, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat, By Heat Immunofluorescence, 5 μg/ml, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 121450 MW
• UniProt ID: Q13621
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Solute carrier family 12 member 1;Bumetanide-sensi
• Note: For research use only
• Application notes: WB: The detection limit for SLC12A1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SLC12A1 using anti-SLC12A1 antibody.Lane 1:monkey kidney tissue;2:rat kidney tissue;3:mouse kidney tissue.

IHC analysis of SLC12A1 using anti-SLC12A1 antibody. SLC12A1 was detected in a paraffin-embedded section of human renal cancer tissue.

IHC analysis of SLC12A1 using anti-SLC12A1 antibody. SLC12A1 was detected in a paraffin-embedded section of mouse kidney tissue.

IHC analysis of SLC12A1 using anti-SLC12A1 antibody. SLC12A1 was detected in a paraffin-embedded section of rat kidney tissue.