You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330513 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SETD2 |
| Target | SETD2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SETD2 |
| Protein Sequence | Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD |
| UniProt ID | Q9BYW2 |
| MW | 97kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ16420 antibody, anti FLJ22472 antibody, an Read more... |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | AAH72440 |

Positive control (+): Hela (HL), Negative control (-): MCF7 (N10), Antibody concentration: 2.5 ug/mL.

Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

SETD2 antibody - N-terminal region (orb330513) validated by IHC using Human Placenta lysate at 4.0-8.0.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5 |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review