SARS-CoV-2 ORF8 Antibody

• Catalog Number: orb738425
• Category: Antibodies
• Description: SARS-CoV-2 ORF8 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: ELISA, 0.001-0.1μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• UniProt ID: P0DTC8
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: ORF8 protein; ORF8; Non-structural protein 8; ns8
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.