You have no items in your shopping cart.
Cart summary
SAG Protein, Human, Recombinant (His)
Catalog Number: orb1977857
| Catalog Number | orb1977857 |
|---|---|
| Category | Proteins |
| Description | Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells. SAG Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 47.1 kDa and the accession number is P10523. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 47.1 kDa (predicted) |
| UniProt ID | P10523 |
| Protein Sequence | MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells. SAG Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 47.1 kDa and the accession number is P10523. |
| Expression Region | 1-405 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
