BXDC5 Rabbit Polyclonal Antibody

• Catalog Number: orb324925
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BXDC5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: RPF1
• UniProt ID: Q9H9Y2
• Protein Sequence: Synthetic peptide located within the following region: AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
• NCBI: NP_079341
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp761G0415 antibody, anti DKFZp761M0215 an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0 ug/mL using anti-BXDC5 antibody (orb324925).

WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/mL, Positive Control: K562 cell lysate.