Cart summary

You have no items in your shopping cart.

RecombinantM-CSF,Mouse

RecombinantM-CSF,Mouse

Catalog Number: orb1494683

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494683
CategoryProteins
DescriptionMacrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
MW35-44 kDa, observed by non-reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 3.3×10ˆ5 units/mg.
StorageLyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesMacrophage Colony Stimulating Factor, CSF-1, Lanim
Read more...
NoteFor research use only
  • RecombinantM-CSF,Mouse [orb1494797]

    > 95% as analyzed by SDS-PAGE.

    30 kDa, observed by reducing SDS-PAGE.

    Escherichia coli.

    50 μg, 10 μg