You have no items in your shopping cart.
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Finegoldia magna ATCC 53516 |
| Tag | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
| Molecular Weight | 86.4 kDa |
| Expression Region | 106-470aa |
| Protein Length | Partial |
| Protein Sequence | KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated [orb2658902]
Greater than 85% as determined by SDS-PAGE.
85 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active) [orb2659610]
Greater than 95% as determined by SDS-PAGE.
44.2 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized anti-CTLA4 antibody at 2 μg/ml can bind Biotinylated Protein L. The EC50 is 1.123-1.761 ng/mL.

The purity of Protein L was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (orb2658567)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
