You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577699 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RACK1 |
Target | RACK1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1 |
Protein Sequence | Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI |
UniProt ID | P63244 |
MW | 35kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1 |
Note | For research use only |
NCBI | NP_006089 |
Immunohistochemistry with Small intestine tissue at an antibody concentration of 5 ug/ml using anti-GNB2L1 antibody (orb577699).
WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Mouse, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |