PVRL2/CD112 Antibody

• Catalog Number: orb1536657
• Category: Antibodies
• Description: PVRL2/CD112 Antibody
• Target: PVRL2 / CD112
• Clonality: Polyclonal
• Species/Host: Rabbit
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Human
• Concentration: 1.22 mg/ml
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purification: Affinity purified
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
• Tested applications: IF, IHC, IHC-P, WB
• Dilution range: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Application notes: Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PVRL2, HVEB, Herpesvirus entry protein B, Poliovir
• Note: For research use only

Immunofluorescence analysis of HeLa cells.

Western blot analysis of extracts of various cell lines.