Prepro-adrenomedullin (153 - 185), human

• Catalog Number: orb2694001
• Category: Proteins
• Description: Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.
• CAS Number: 166546-72-1
• Purity: ≥95%
• MW: 3219.6
• Formula: C₁₄₃H₂₂₄N₄₂O₄₃
• Target: others
• Protein Sequence: SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
• Note: For research use only
• Expiration Date: 6 months from date of receipt.