The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613).