You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216358 |
---|---|
Category | Proteins |
Description | The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613). |
Target | CCL5 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS |
Protein Length | 68 |
MW | 7.9 kDa |
Source | Yeast |
Biological Origin | Swine |
Storage | -20°C |
Alternative names | RANTES |
Note | For research use only |