PLCG1 monoclonal antibody (M01), clone 2A2

• Catalog Number: orb2292391
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PLCG1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A2
• Tested applications: ELISA, IF, PLA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
• NCBI: NP_002651
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PLCG1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40 ug/ml]

PLCG1 monoclonal antibody (M01), clone 2A2 Western Blot analysis of PLCG1 expression in Hela S3 NE.

Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).