You have no items in your shopping cart.
Plant Gliadin Gamma Protein
SKU: orb425745
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH |
| Purity | Protein is >90% pure. |
Storage & Handling
−| Storage | Stability: Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | Gliadin Gamma protein solution (1mg/ml) in 10mM Tris-HCl pH 7.2. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Plant Triticum aestivum Gamma-gliadin protein [orb705097]
Greater than 85% as determined by SDS-PAGE.
41.2 kDa
E.coli
1 mg, 20 μg, 100 μgPlant Gliadin Gamma 18.6kDa Protein [orb168397]
Greater than 95% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Plant Gliadin Gamma Protein (orb425745)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review