You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb425745 |
|---|---|
| Category | Proteins |
| Description | Recombinant of plant Gliadin Gamma protein |
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | Gliadin Gamma protein solution (1mg/ml) in 10mM Tris-HCl pH 7.2. |
| Purity | Protein is >90% pure. |
| Protein Sequence | MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH |
| Application notes | Recombinant & Natural Proteins |
| Source | Escherichia Coli |
| Storage | Stability: Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
41.2 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
Escherichia Coli |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review