PHGDH monoclonal antibody (M01), clone 4A3-1D6

• Catalog Number: orb2291269
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PHGDH.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A3-1D6
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
• NCBI: AAH11262.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PHGDH is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PHGDH on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1 ~ 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]

Immunoprecipitation of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH MaxPab rabbit polyclonal antibody.

PHGDH monoclonal antibody (M01), clone 4A3-1D6 Western Blot analysis of PHGDH expression in Jurkat.

PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in A-431.

PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in human liver.

Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody (M01), clone 4A3-1D6. Lane 1: PHGDH transfected lysate(56.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (84.37 KDa).