PCTP Rabbit Polyclonal Antibody

SKU: orb585911

Description

Rabbit polyclonal antibody to PCTP

Research Area

Epigenetics

Images & Validation

• Tested Applications: IHC
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP
• Target: PCTP
• Protein Sequence: Synthetic peptide located within the following region: VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP
• Molecular Weight: 25 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PC-TP, STARD2

Sample Type: Lane 1: 40 ug Human Liver lysate, Lane 2: 40 ug Mouse Liver lysate, Lane 3: 40 ug Rat Liver lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647, Secondary Antibody dilution: 1:2500.

Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

PCTP

UniProt

Q9UKL6

RefSeq (Protein):NP_067036