You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585911 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PCTP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25 kDa |
Target | PCTP |
UniProt ID | Q9UKL6 |
Protein Sequence | Synthetic peptide located within the following region: VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP |
NCBI | NP_067036 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PC-TP, STARD2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Lane 1: 40 ug Human Liver lysate, Lane 2: 40 ug Mouse Liver lysate, Lane 3: 40 ug Rat Liver lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647, Secondary Antibody dilution: 1:2500.
Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |