You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585911 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PCTP |
| Target | PCTP |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP |
| Protein Sequence | Synthetic peptide located within the following region: VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP |
| UniProt ID | Q9UKL6 |
| MW | 25 kDa |
| Tested applications | IHC |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PC-TP, STARD2 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_067036 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: Lane 1: 40 ug Human Liver lysate, Lane 2: 40 ug Mouse Liver lysate, Lane 3: 40 ug Rat Liver lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647, Secondary Antibody dilution: 1:2500.

Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PCTP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Gallus, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review