PCNA monoclonal antibody (M04), clone S1

• Catalog Number: orb2292441
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PCNA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S1
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b Kappa
• Immunogen: PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• NCBI: AAH00491
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PCNA is approximately 0.1 ng/ml as a capture antibody.

PCNA monoclonal antibody (M04), clone S1 Western Blot analysis of PCNA expression in Hela S3 NE.

PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in NIH/3T3.

PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in PC-12.

PCNA monoclonal antibody (M04), clone S1. Western Blot analysis of PCNA expression in Raw 264.7.

Western Blot analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody (M04), clone S1. Lane 1: PCNA transfected lysate (28.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (54.45 KDa).