Availability

Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Parasite LDBPK_361420 protein
Catalog Number orb604479
ReactivityParasite
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Target LDBPK_361420
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Tag N-terminal 6xHis-tagged
Note For research use only.
Protein Sequence NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD
Purity >85% as determined by SDS-PAGE.
MW 13.7 kDa
Source E.coli
Expression Region 15-98aa
Uniprot ID E9BTK1
Product Description

Recombinant Leishmania donovani Transitional endoplasmic reticulum ATPase,putative(LDBPK_361420),partial

Application Notes
Application Notes Partial
Reviews
Write Your Own Review
You're reviewing:Parasite LDBPK_361420 protein - orb604479
Your Rating