PAF1 Rabbit Polyclonal Antibody

• Catalog Number: orb585035
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: PAF1
• UniProt ID: Q8N7H5
• Protein Sequence: Synthetic peptide located within the following region: IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ
• NCBI: NP_061961
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PD2, F23149_1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PAF1 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. PAF1 is supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-PAF1 Antibody, Catalog Number: orb585035, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PAF1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.