OXT Protein, Human, Recombinant (His)

• Catalog Number: orb1978096
• Category: Proteins
• Description: Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 11.6 kDa (predicted)
• UniProt ID: P01178
• Protein Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Biological Activity: Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
• Expression Region: 32-125 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.