You have no items in your shopping cart.
Cart summary
OX1R Protein, Human, Recombinant (His & SUMOstar)
Catalog Number: orb1978100
| Catalog Number | orb1978100 |
|---|---|
| Category | Proteins |
| Description | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613. |
| Tag | N-6xHis-SUMOstar |
| Purity | 98.00% |
| MW | 21.4 kDa (predicted) |
| UniProt ID | O43613 |
| Protein Sequence | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613. |
| Expression Region | 1-46 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
