You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292507 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant NODAL. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5C3 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC |
NCBI | NP_060525 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged NODAL is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to NODAL on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]
NODAL monoclonal antibody (M03), clone 5C3 Western Blot analysis of NODAL expression in HeLa.
NODAL monoclonal antibody (M03), clone 5C3. Western Blot analysis of NODAL expression in PC-12.
NODAL monoclonal antibody (M03), clone 5C3. Western Blot analysis of NODAL expression in Raw 264.7.
Western Blot detection against Immunogen (33.66 KDa).