You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381082 |
---|---|
Category | Antibodies |
Description | NFIA Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Gallus, Hamster, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, MouseImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55944 MW |
UniProt ID | Q12857 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Nuclear factor 1 A-type;NF1-A;Nuclear factor 1/A;C Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of K562 cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of SiHa cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of NFIA using anti-NFIA antibody.Lane 1:JURKAT cell;2:COLO320 cell.
WB analysis of NFIA using anti-NFIA antibody.Lane 1:mouse HEPA1-6 cell;2:mouse SP2/0 cell.
IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of mouse liver tissues.
IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of rat liver tissues.
IHC analysis of NFIA using anti-NFIA antibody.NFIA was detected in paraffin-embedded section of human mammary cancer tissues.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating