MYH9 monoclonal antibody (M03), clone 2B3

• Catalog Number: orb2292550
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MYH9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
• NCBI: NP_002464.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MYH9 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MYH9 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 0.5 ug/ml]

MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in HeLa.

MYH9 monoclonal antibody (M03), clone 2B3. Western Blot analysis of MYH9 expression in human kidney.

Western Blot analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3. Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).