You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383064 |
---|---|
Category | Proteins |
Description | Recombinant mouse Ube3a protein. |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 39.9 kDa |
UniProt ID | O08759 |
Protein Sequence | NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 542-870aa. Protein Length: Partial |
Expression Region | 542-870aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Oncogenic protein-associated protein E6-AP Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
41.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
40.9 kDa | |
Mammalian cell |
Mouse | |
0.312-20ng/mL | |
0.107ng/mL |
Filter by Rating