You have no items in your shopping cart.
MGST2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MGST2 |
| Target | MGST2 |
| Protein Sequence | Synthetic peptide located within the following region: MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF |
| Molecular Weight | 16kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MGST2 rabbit pAb Antibody [orb769115]
ELISA, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlMGST2 polyclonal antibody [orb644999]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human Muscle

WB Suggested Anti-MGST2 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. MGST2 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
MGST2 Rabbit Polyclonal Antibody (orb579430)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




