You have no items in your shopping cart.
Cart summary
LTBR Peptide - C-terminal region
Catalog Number: orb1999998
| Catalog Number | orb1999998 |
|---|---|
| Category | Proteins |
| Description | LTBR Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: IYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHL |
| UniProt ID | P36941 |
| MW | 47 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with LTBR Rabbit Polyclonal Antibody (orb589771). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CD18, TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, TNF Read more... |
| Note | For research use only |
| NCBI | NP_001257916.1 |
