LGALS3BP Antibody

• Catalog Number: orb412983
• Category: Antibodies
• Description: LGALS3BP Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section),0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 75 kDa
• UniProt ID: Q08380
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Galectin-3-binding protein; Basement membrane auto
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of LGALS3BP using anti-LGALS3BP antibody.Lane 1:human HeLa cell;2:human COLO-320 cell;3:mouse HEPA1-6 cell.

IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of mouse small intestine tissue.

IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human lung cancer tissue.