
  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name KRT19 antibody
Catalog Number orb421122
Tested applicationsIHC-P, WB
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR).
Target KRT19
Product Properties
Form/Appearance Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Reconstitution Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype IgG1
Purity Immunogen affinity purified.
Clone ID 3D4
Uniprot ID P08727
Product Description

Rabbit polyclonal antibody to KRT19

Application Notes
Dilution Range WB: 0.1-0.5 μg/ml, IHC-P: 0.5-1 μg/ml
Write Your Own Review
You're reviewing:KRT19 antibody - orb421122
Your Rating