You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1147094 |
---|---|
Category | Proteins |
Description | Disrupts TGF-β/TβR2 interaction; Peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 3228.48 Da |
Formula | C149H203N39O43 |
Solubility (25°C) | Soluble in water |
Protein Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
Storage | Store dry, frozen and in the dark |
Alternative names | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG, KP-1,, KP1, KP1 (h Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
FC, IF, IHC, IHC-P, IP, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating