KIAA0319 Rabbit Polyclonal Antibody

• Catalog Number: orb325314
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIAA0319
• Target: KIAA0319
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0319
• Protein Sequence: Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
• UniProt ID: Q5VV43
• MW: 56kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DLX2 antibody, anti DYLX2 antibody, anti DYX2
• Note: For research use only
• NCBI: EAW55455

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Human kidney

WB Suggested Anti-KIAA0319 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.