KDR Rabbit Polyclonal Antibody

• Catalog Number: orb592822
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KDR
• Target: KDR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KDR
• Protein Sequence: Synthetic peptide located within the following region: LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD
• UniProt ID: P35968
• MW: 151kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FLK1, CD309, VEGFR, VEGFR2
• Note: For research use only
• NCBI: NP_002244

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

KDR in endothelial cells in blood vessels in placenta was detected using HRP/AEC red color stain. recommended for IHC on human tissue. 5-10 ug/ml.

Application: IHC, Species+tissue/cell type: Control-Human Placenta, Sample-Human colorectal cancer, Primary antibody dilution: 1:100, Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP.

WB Suggested Anti-KDR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.