You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb329883 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KCTD11 |
| Target | KCTD11 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Mouse |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD11 |
| Protein Sequence | Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH |
| UniProt ID | Q693B1 |
| MW | 26kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti REN antibody, anti KCASH1 antibody, anti C17o Read more... |
| Research Area | Signal Transduction, Stem Cell & Developmental Bio Read more... |
| Note | For research use only |
| NCBI | NP_001002914 |

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-KCTD11 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
ICC, IF | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review