You have no items in your shopping cart.
Cart summary
KCNA5 Peptide - middle region
Catalog Number: orb1999214
| Catalog Number | orb1999214 |
|---|---|
| Category | Proteins |
| Description | KCNA5 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: RLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIR |
| UniProt ID | Q16322 |
| MW | 56 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | HK2, HCK1, PCN1, ATFB7, HPCN1, KV1.5 |
| Note | For research use only |
| NCBI | NP_002225.2 |
