Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Insect HSP90 protein
Catalog Number orb55639
ReactivityInsect
ConjugationUnconjugated
Tested applicationsSDS-PAGE, WB
Target HSP90
Alternative Names
Product Properties
Form/Appearance 50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol
Concentration 1.3 mg/ml
Storage Store at -20°C
Note For research use only.
Protein Sequence QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL
Purity Affinity Purified
MW 234 kDa
Source E. coli
Uniprot ID Q8IL32
Entrez 811999
Product Description

Recombinant insect HSP90 protein

Reviews
Write Your Own Review
You're reviewing:Insect HSP90 protein - orb55639
Your Rating