INS antibody

• Catalog Number: orb334979
• Category: Antibodies
• Description: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin. An increase in blood glucose levels during stimulates insulin release from pancreatic β cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IHC-Fr, IHC-P, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Purified recombinant human Insulin produced in E. coli as a fusion protein.
• Concentration: 3 mg/ml
• Dilution range: WB:1:250-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Conjugation: Unconjugated
• Target: INS
• Protein Sequence: MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN
• Storage: Store at -20°C for long-term storage. Store at 2-8°C for up to one month.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10 antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of staining of MBP-INS cells lysate using INS antibody