Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TP53 Rabbit Polyclonal Antibody

SKU: orb573617

Description

Rabbit polyclonal antibody to p53

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsChIP, IHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TP53
TargetTP53
Protein SequenceSynthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Molecular Weight44 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P53, BCC7, LFS1, BMFS5, TRP53

Similar Products

  • P53 protein (wt-p53) Rabbit Polyclonal Antibody [orb11210]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • P53 (Acetyl K382) Rabbit Polyclonal Antibody [orb11497]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • P53 (FL-393) Rabbit Polyclonal Antibody [orb2664]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-P53 (Ser33) Rabbit Polyclonal Antibody [orb6596]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • 53BP1/TP53BP1 Rabbit Polyclonal Antibody [orb1145798]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TP53 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 44 kDa isoform is identified, and a second isoform of 34 kDa is also present in some samples. TP53 has > 12 isoforms, and this peptide is present in isoform 1, 2, 3, 6, and others.

TP53 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

TP53 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

TP53 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

TP53 Rabbit Polyclonal Antibody

Immunohistochemistry with U20S/ PLKO cells tissue.

TP53 Rabbit Polyclonal Antibody

Immunohistochemistry with U20S/ PLKO cells tissue.

TP53 Rabbit Polyclonal Antibody

Rabbit Anti-TP53 Antibody, Catalog Number: orb573617, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

TP53 Rabbit Polyclonal Antibody

Sample Type: U20S/ PLKO cells.

TP53 Rabbit Polyclonal Antibody

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000537

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

TP53 Rabbit Polyclonal Antibody (orb573617)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry