IGFBP4 Rabbit Polyclonal Antibody

• Catalog Number: orb579539
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGFBP4
• Target: IGFBP4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
• Protein Sequence: Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
• UniProt ID: P22692
• MW: 28kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BP-4, IBP4, IGFBP-4, HT29-IGFBP
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_001543
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-IGFBP4 antibody (orb579539).

WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.