You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245088 |
---|---|
Category | Proteins |
Description | Recombinant human 14-3-3 protein beta/alpha |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 55.1 kDa |
UniProt ID | P31946 |
Protein Sequence | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
Protein Length | Full Length |
Source | E.coli |
Expression System | Expression Region: 1-246aa. Protein Length: Full Length |
Expression Region | 1-246aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | YWHAB Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
43.2 kDa | |
Human ROR2, His Tag (orb348799) is expressed from human 293 cells (HEK293). It contains AA Glu 34 - Gly 403 (Accession # NP_004551.1). |
Unconjugated | |
95% | |
68 kDa | |
Human ROR2, Fc Tag (orb257799) is expressed from human 293 cells (HEK293). It contains AA Glu 34 - Gly 403 (Accession # A1L4F5-1). |
Human | |
6.25 ng/mL-400 ng/mL | |
1.56 ng/mL |
Filter by Rating