Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | Human VEGF (121 a.a.) (Sf9) protein |
---|---|
Catalog Number | orb429177 |
Reactivity | Human |
Conjugation | Unconjugated |
Target | VEGF (121 a.a.) (Sf9) |
Product Properties
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized from a solution containing 50mM acetic acid. |
---|---|
Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Note | For research use only. |
Protein Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR. |
Purity | >95.0% as determined by SDS-PAGE. |
Source | Sf9, Insect Cells. |
Activity | Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml. |
Product Description
Recombinant of human VEGF (121 a.a.) (Sf9) protein
Solubility (25°C)
Solubility (25°C) | The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50μg/ml. |
---|
Reviews
Write Your Own Review