Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human VEGF (121 a.a.) (Sf9) protein
Catalog Number orb429177
ReactivityHuman
ConjugationUnconjugated
Target VEGF (121 a.a.) (Sf9)
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
The protein was lyophilized from a solution containing 50mM acetic acid.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.
Purity >95.0% as determined by SDS-PAGE.
Source Sf9, Insect Cells.
Activity Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
Product Description

Recombinant of human VEGF (121 a.a.) (Sf9) protein

Solubility (25°C)
Solubility (25°C) The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50μg/ml.
Reviews
Write Your Own Review
You're reviewing:Human VEGF (121 a.a.) (Sf9) protein - orb429177
Your Rating