You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb418833 |
---|---|
Category | Proteins |
Description | Recombinant Human cytomegalovirus Uncharacterized UL128 |
Tag | Tag-Free |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 19.7 kDa |
UniProt ID | P16837 |
Protein Sequence | MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ |
Protein Length | Full Length |
Source | Yeast |
Expression System | Expression Region: 1-171aa. Protein Length: Full Length |
Expression Region | 1-171aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | UL128Uncharacterized protein UL128 Read more... |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 1-171aaSequence Info: Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
23.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
21.7 kDa | |
Yeast |
Unconjugated | |
90% | |
82.6 kDa & 27.6 kDa & 52.6 kDa | |
HHV-5 (strain AD169) gH&gL&gO, Twin-Strep Tag&Tag Free&His Tag is expressed from human 293 cells (HEK293). It contains AA Arg 24 - Leu 720 & Val 31 - Arg 278 & Lys 31 - Gln 466 (Accession # P12824 & P16832 & P16750). |
Filter by Rating