Human UBE2L3 (His) Protein

• Catalog Number: orb429082
• Category: Proteins
• Description: Recombinant of human UBE2L3 (His) protein
• Form/Appearance: Sterile Filtered white lyophilized powder.
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Solubility (25°C): It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
• Source: Escherichia Coli
• Storage: Stability: Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
• Alternative names: Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, U
• Note: For research use only
• Application notes: Enzymes
• Expiration Date: 6 months from date of receipt.