You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245193 |
---|---|
Category | Proteins |
Description | Recombinant human Tubulin beta-3 chain protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 50.1 kDa |
Target | TUBB3 |
UniProt ID | Q13509 |
Protein Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI |
Protein Length | Partial |
Source | E.coli |
Expression System | 1-210aa |
Expression Region | 1-210aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | TUBB3 Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
50.1 kDa | |
E.coli |
Unconjugated | |
95% | |
67.5 kDa | |
Human Netrin-1, His Tag (orb762415) is expressed from human 293 cells (HEK293). It contains AA Val 22 - Ala 604 (Accession # O95631-1). |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
49.4 kDa | |
E.Coli |
Filter by Rating