Human SPRC protein

• Catalog Number: orb419320
• Category: Proteins
• Description: Recombinant Human SPARC active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• MW: 32.7 kDa
• UniProt ID: P09486
• Protein Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• Protein Length: Partial
• Source: E.Coli
• Expression System: Expression Region: 18-303aa. Protein Length: Partial
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg.
• Expression Region: 18-303aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Alternative names: Basement-membrane protein 40, Osteonectin, ON, Sec
• Note: For research use only
• Application notes: Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Human SPRC protein