Human SPRC protein

SKU: orb419320

Description

This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg.
• Tag: Tag-Free
• Molecular Weight: 32.7 kDa
• Expression Region: 18-303aa
• Protein Length: Partial
• Protein Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine,

Quick Database Links

UniProt

P09486