You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb359252 |
|---|---|
| Category | Proteins |
| Description | Recombinant human SPRC active protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | MSYYHHHHHHDYDIPTTENLYFQGAMGSA+PQQEALPDETEVVEETVAEVT EVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENN TPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGH KLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLT EKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLD QHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGC FGIKQKDIDKDLVI |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P09486 |
| MW | 36.1 kDa |
| Application notes | This is His protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg. |
| Expression Region | 18-303aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Basement-membrane protein 40, Osteonectin, ON, Sec Read more... |
| Research Area | Cancer Biology |
| Note | For research use only |

SDS-PAGE analysis of Human SPRC protein (Active)
> 98% as determined by SDS-PAGE and HPLC. | |
32.7 kDa | |
E.Coli |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review