Cart summary

You have no items in your shopping cart.

Human SPRC protein (Active)

SKU: orb359252
ActiveBiologically Active

Description

This Human SPRC protein (Active) spans the amino acid sequence from region 18-303aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

Application Notes
This is His protein

Key Properties

SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg.
TagN-terminal 6xHis-tagged
Molecular Weight36.1 kDa
Expression Region18-303aa
Protein LengthFull Length of Mature Protein
Protein SequenceMSYYHHHHHHDYDIPTTENLYFQGAMGSA+PQQEALPDETEVVEETVAEVT EVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENN TPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGH KLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLT EKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLD QHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGC FGIKQKDIDKDLVI
Purity> 95% as determined by SDS-PAGE and HPLC.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine,
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human SPRC protein (Active)

SDS-PAGE analysis of Human SPRC protein (Active)

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human SPRC protein (Active) (orb359252)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 170.00
100 μg
$ 610.00
500 μg
$ 1,330.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry